Class a: All alpha proteins [46456] (285 folds) |
Fold a.193: GRIP domain [101282] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.193.1: GRIP domain [101283] (1 family) |
Family a.193.1.1: GRIP domain [101284] (1 protein) |
Protein Golgi autoantigen, golgin-245 [101285] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries) |
Domain d1r4af_: 1r4a F: [96991] Other proteins in same PDB: d1r4aa_, d1r4ab_, d1r4ac_, d1r4ad_ complexed with gnp, mg |
PDB Entry: 1r4a (more details), 2.3 Å
SCOPe Domain Sequences for d1r4af_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4af_ a.193.1.1 (F:) Golgi autoantigen, golgin-245 {Human (Homo sapiens) [TaxId: 9606]} ptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmf
Timeline for d1r4af_: