Lineage for d1r4af_ (1r4a F:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362464Fold a.193: GRIP domain [101282] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 362465Superfamily a.193.1: GRIP domain [101283] (1 family) (S)
  5. 362466Family a.193.1.1: GRIP domain [101284] (1 protein)
  6. 362467Protein Golgi autoantigen, golgin-245 [101285] (1 species)
  7. 362468Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries)
  8. 362474Domain d1r4af_: 1r4a F: [96991]
    Other proteins in same PDB: d1r4aa_, d1r4ab_, d1r4ac_, d1r4ad_

Details for d1r4af_

PDB Entry: 1r4a (more details), 2.3 Å

PDB Description: Crystal Structure of GTP-bound ADP-ribosylation Factor Like Protein 1 (Arl1) and GRIP Domain of Golgin245 COMPLEX

SCOP Domain Sequences for d1r4af_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4af_ a.193.1.1 (F:) Golgi autoantigen, golgin-245 {Human (Homo sapiens)}
ptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmf

SCOP Domain Coordinates for d1r4af_:

Click to download the PDB-style file with coordinates for d1r4af_.
(The format of our PDB-style files is described here.)

Timeline for d1r4af_: