![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin [52835] (16 species) |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [102430] (1 PDB entry) |
![]() | Domain d1r26a1: 1r26 A:1-105 [96847] Other proteins in same PDB: d1r26a2 |
PDB Entry: 1r26 (more details), 1.4 Å
SCOPe Domain Sequences for d1r26a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r26a1 c.47.1.1 (A:1-105) Thioredoxin {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} svvdvysveqfrnimsediltvawftavwcgpcktierpmekiayefptvkfakvdadnn seivskcrvlqlptfiiarsgkmlghviganpgmlrqklrdiikd
Timeline for d1r26a1: