SCOPe 2.08: Domain d1r26a1: 1r26 A:1-105

Lineage for d1r26a1 (1r26 A:1-105)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [102430] (1 PDB entry)

8. Domain d1r26a1: 1r26 A:1-105 [96847]
   Other proteins in same PDB: d1r26a2

Details for d1r26a1

PDB Entry: 1r26, 1.4 Å

PDB Description: Crystal structure of thioredoxin from Trypanosoma brucei brucei

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1r26a1:

Sequence; same for both SEQRES and ATOM records:

>d1r26a1 c.47.1.1 (A:1-105) Thioredoxin {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
svvdvysveqfrnimsediltvawftavwcgpcktierpmekiayefptvkfakvdadnn
seivskcrvlqlptfiiarsgkmlghviganpgmlrqklrdiikd

Timeline for d1r26a1:

• d1r26a1 first appeared in SCOP 1.67, called d1r26a_
  
• d1r26a1 appears in SCOPe 2.07