Lineage for d1r26a_ (1r26 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395955Species Trypanosoma brucei [TaxId:5691] [102430] (1 PDB entry)
  8. 395956Domain d1r26a_: 1r26 A: [96847]

Details for d1r26a_

PDB Entry: 1r26 (more details), 1.4 Å

PDB Description: Crystal structure of thioredoxin from Trypanosoma brucei brucei

SCOP Domain Sequences for d1r26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei}
irmrarypsvvdvysveqfrnimsediltvawftavwcgpcktierpmekiayefptvkf
akvdadnnseivskcrvlqlptfiiarsgkmlghviganpgmlrqklrdiikd

SCOP Domain Coordinates for d1r26a_:

Click to download the PDB-style file with coordinates for d1r26a_.
(The format of our PDB-style files is described here.)

Timeline for d1r26a_: