Lineage for d1qzxb2 (1qzx B:295-432)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709937Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 2709938Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) (S)
  5. 2709939Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 2709940Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 2709956Species Sulfolobus solfataricus [TaxId:2287] [101170] (2 PDB entries)
  8. 2709958Domain d1qzxb2: 1qzx B:295-432 [96715]
    Other proteins in same PDB: d1qzxa1, d1qzxa3, d1qzxb1, d1qzxb3
    has additional insertions and/or extensions that are not grouped together

Details for d1qzxb2

PDB Entry: 1qzx (more details), 4 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
PDB Compounds: (B:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1qzxb2:

Sequence, based on SEQRES records: (download)

>d1qzxb2 a.36.1.1 (B:295-432) Signal sequence binding protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
gdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipg
lgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveev
rellewynnmnrllkmvk

Sequence, based on observed residues (ATOM records): (download)

>d1qzxb2 a.36.1.1 (B:295-432) Signal sequence binding protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
gdiesilekvkgleeydkiqkkmedltlrdvyaqiialrkmgplskvlqhipglgimlpt
psedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellewy
nnmnrllkmvk

SCOPe Domain Coordinates for d1qzxb2:

Click to download the PDB-style file with coordinates for d1qzxb2.
(The format of our PDB-style files is described here.)

Timeline for d1qzxb2: