SCOP 1.67: Domain d1qzxb2: 1qzx B:295-432

Lineage for d1qzxb2 (1qzx B:295-432)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101170] (2 PDB entries)

8. Domain d1qzxb2: 1qzx B:295-432 [96715]
   Other proteins in same PDB: d1qzxa1, d1qzxa3, d1qzxb1, d1qzxb3

Details for d1qzxb2

PDB Entry: 1qzx, 4 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

SCOP Domain Sequences for d1qzxb2:

Sequence, based on SEQRES records:

>d1qzxb2 a.36.1.1 (B:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus}
gdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipg
lgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveev
rellewynnmnrllkmvk

Sequence, based on observed residues (ATOM records):

>d1qzxb2 a.36.1.1 (B:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus}
gdiesilekvkgleeydkiqkkmedltlrdvyaqiialrkmgplskvlqhipglgimlpt
psedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellewy
nnmnrllkmvk

Timeline for d1qzxb2:

• d1qzxb2 is new in SCOP 1.67
  
• d1qzxb2 appears in SCOP 1.69
  
• d1qzxb2 appears in the current release, SCOPe 2.08