Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) |
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
Protein Signal sequence recognition protein Ffh [47366] (3 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101121] (2 PDB entries) |
Domain d1qzxb1: 1qzx B:1-87 [96714] Other proteins in same PDB: d1qzxa2, d1qzxa3, d1qzxb2, d1qzxb3 |
PDB Entry: 1qzx (more details), 4 Å
SCOP Domain Sequences for d1qzxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzxb1 a.24.13.1 (B:1-87) Signal sequence recognition protein Ffh {Archaeon Sulfolobus solfataricus [TaxId: 2287]} mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp psvlerkewfisivydelsklfggdke
Timeline for d1qzxb1: