Lineage for d1qzxa1 (1qzx A:1-87)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765693Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 765694Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 765714Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 765718Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101121] (2 PDB entries)
  8. 765719Domain d1qzxa1: 1qzx A:1-87 [96711]
    Other proteins in same PDB: d1qzxa2, d1qzxa3, d1qzxb2, d1qzxb3

Details for d1qzxa1

PDB Entry: 1qzx (more details), 4 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
PDB Compounds: (A:) signal recognition 54 kda protein

SCOP Domain Sequences for d1qzxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzxa1 a.24.13.1 (A:1-87) Signal sequence recognition protein Ffh {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mlenirdavrkfltgstpyekavdefikdlqkslissdvnvklvfsltakikerlnkekp
psvlerkewfisivydelsklfggdke

SCOP Domain Coordinates for d1qzxa1:

Click to download the PDB-style file with coordinates for d1qzxa1.
(The format of our PDB-style files is described here.)

Timeline for d1qzxa1: