Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein ATPase domain of protease Lon (La) [102393] (2 species) |
Species Escherichia coli [TaxId:562] [102394] (1 PDB entry) |
Domain d1qzma_: 1qzm A: [96651] C-terminal all-alpha subdomain only |
PDB Entry: 1qzm (more details), 1.9 Å
SCOPe Domain Sequences for d1qzma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} sgytedeklniakrhllpkqiernalkkgeltvddsaiigiiryytreagvrglereisk lcrkavkqllldkslkhieingdnlhdylgvqrf
Timeline for d1qzma_: