SCOPe 2.01: Domain d1qzma_: 1qzm A:

Lineage for d1qzma_ (1qzm A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein ATPase domain of protease Lon (La) [102393] (1 species)

7. Species Escherichia coli [TaxId:562] [102394] (1 PDB entry)

8. Domain d1qzma_: 1qzm A: [96651]
   C-terminal all-alpha subdomain only

Details for d1qzma_

PDB Entry: 1qzm, 1.9 Å

PDB Description: alpha-domain of atpase

PDB Compounds: (A:) ATP-dependent protease La

SCOPe Domain Sequences for d1qzma_:

Sequence; same for both SEQRES and ATOM records:

>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]}
sgytedeklniakrhllpkqiernalkkgeltvddsaiigiiryytreagvrglereisk
lcrkavkqllldkslkhieingdnlhdylgvqrf

Timeline for d1qzma_:

• d1qzma_ first appeared in SCOP 1.67
  
• d1qzma_ appears in SCOP 1.75
  
• d1qzma_ appears in SCOPe 2.02
  
• d1qzma_ appears in the current release, SCOPe 2.08