Lineage for d1qzgb_ (1qzg B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789394Protein Protection of telomeres protein 1, Pot1 [101761] (2 species)
  7. 2789395Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101762] (2 PDB entries)
  8. 2789397Domain d1qzgb_: 1qzg B: [96644]
    protein/DNA complex; complexed with tmp
    has additional insertions and/or extensions that are not grouped together

Details for d1qzgb_

PDB Entry: 1qzg (more details), 1.9 Å

PDB Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex
PDB Compounds: (B:) Protection of telomeres protein 1

SCOPe Domain Sequences for d1qzgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzgb_ b.40.4.3 (B:) Protection of telomeres protein 1, Pot1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn

SCOPe Domain Coordinates for d1qzgb_:

Click to download the PDB-style file with coordinates for d1qzgb_.
(The format of our PDB-style files is described here.)

Timeline for d1qzgb_: