PDB entry 1qzg

View 1qzg on RCSB PDB site
Description: Crystal structure of Pot1 (protection of telomere)- ssDNA complex
Class: DNA BINDING Protein/DNA
Keywords: protrein-DNA complex, single-stranded telomeric DNA, DNA BINDING Protein/DNA COMPLEX
Deposited on 2003-09-16, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protection of telomeres protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qzga_
  • Chain 'B':
    Compound: Protection of telomeres protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: POT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qzgb_
  • Chain 'C':
    Compound: telomeric single-stranded DNA
  • Chain 'D':
    Compound: telomeric single-stranded DNA
  • Heterogens: TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qzgA (A:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzgA (A:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qzgB (B:)
    gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
    lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
    tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
    gellsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qzgB (B:)
    vidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqslhgtkd
    wvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdrtqglsk
    dqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.