SCOPe 2.08: Domain d1qz4a1: 1qz4 A:2-213

Lineage for d1qz4a1 (1qz4 A:2-213)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.198: YcfC-like [101321] (1 superfamily)
   multihelical; contains two buried central helices

4. Superfamily a.198.1: YcfC-like [101322] (1 family)
   automatically mapped to Pfam PF04356

5. Family a.198.1.1: YcfC-like [101323] (1 protein)
   Pfam PF04356; DUF489

6. Protein Hypothetical protein YcfC [101324] (1 species)

7. Species Escherichia coli [TaxId:562] [101325] (2 PDB entries)
   Uniprot P25746

8. Domain d1qz4a1: 1qz4 A:2-213 [96613]
   Other proteins in same PDB: d1qz4a2
   structural genomics
   complexed with hg, po4

Details for d1qz4a1

PDB Entry: 1qz4, 2 Å

PDB Description: Structure of YcfC Protein of Unknown Function Escherichia coli

PDB Compounds: (A:) Hypothetical protein ycfC

SCOPe Domain Sequences for d1qz4a1:

Sequence; same for both SEQRES and ATOM records:

>d1qz4a1 a.198.1.1 (A:2-213) Hypothetical protein YcfC {Escherichia coli [TaxId: 562]}
aknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggsean
lrvgletllgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrqle
hfdlqsetlmsamaaiyvdvisplgpriqvtgspavlqspqvqakvratllagiraavlw
hqvgggrlqlmfsrnrlttqakqilahltpel

Timeline for d1qz4a1:

• d1qz4a1 first appeared in SCOP 1.67, called d1qz4a_
  
• d1qz4a1 appears in SCOPe 2.07