PDB entry 1qz4

View 1qz4 on RCSB PDB site
Description: Structure of YcfC Protein of Unknown Function Escherichia coli
Class: Structural genomics, unknown function
Keywords: Structural genomics, helix-turn-helix motif, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2003-09-15, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ycfC
    Species: Escherichia coli [TaxId:562]
    Gene: YCFC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25746 (1-212)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1qz4a1, d1qz4a2
  • Heterogens: PO4, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qz4A (A:)
    gaknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggsea
    nlrvgletllgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrql
    ehfdlqsetlmsamaaiyvdvisplgpriqvtgspavlqspqvqakvratllagiraavl
    whqvgggrlqlmfsrnrlttqakqilahltpel