Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Major urinary protein/alpha-2u-globulin [50832] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50833] (19 PDB entries) |
Domain d1qy0a_: 1qy0 A: [96567] complexed with cd, gol, na |
PDB Entry: 1qy0 (more details), 1.8 Å
SCOPe Domain Sequences for d1qy0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qy0a_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]} eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly grepdlssdikerfaqlceehgilreniidlsnanrc
Timeline for d1qy0a_: