Lineage for d1qxsb1 (1qxs B:1-164,B:334-359)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687423Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)
  7. 687628Species Trypanosoma cruzi [TaxId:5693] [75104] (3 PDB entries)
  8. 687638Domain d1qxsb1: 1qxs B:1-164,B:334-359 [96556]
    Other proteins in same PDB: d1qxsa2, d1qxsb2, d1qxsc2, d1qxsd2

Details for d1qxsb1

PDB Entry: 1qxs (more details), 2.75 Å

PDB Description: crystal structure of trypanosoma cruzi glyceraldehyde-3- phosphate dehydrogenase complexed with an analogue of 1,3- bisphospho-d- glyceric acid
PDB Compounds: (B:) Glyceraldehyde 3-phosphate dehydrogenase, glycosomal

SCOP Domain Sequences for d1qxsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxsb1 c.2.1.3 (B:1-164,B:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

SCOP Domain Coordinates for d1qxsb1:

Click to download the PDB-style file with coordinates for d1qxsb1.
(The format of our PDB-style files is described here.)

Timeline for d1qxsb1: