SCOPe 2.08: Domain d1qxha_: 1qxh A:

Lineage for d1qxha_ (1qxh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thiol peroxidase Tpx [102452] (4 species)

7. Species Escherichia coli [TaxId:562] [102453] (1 PDB entry)

8. Domain d1qxha_: 1qxh A: [96528]

Details for d1qxha_

PDB Entry: 1qxh, 2.2 Å

PDB Description: Crystal Structure of Escherichia coli Thiol Peroxidase in the Oxidized State

PDB Compounds: (A:) Thiol Peroxidase

SCOPe Domain Sequences for d1qxha_:

Sequence; same for both SEQRES and ATOM records:

>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]}
sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvc
aasvrkfnqlateidntvvlcisadlpfaqsrfcgaeglnnvitlstfrnaeflqaygva
iadgplkglaaravvvidendnvifsqlvdeittepdyeaalav

Timeline for d1qxha_:

• d1qxha_ first appeared in SCOP 1.67
  
• d1qxha_ appears in SCOPe 2.07