Lineage for d1qxhb_ (1qxh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877709Protein Thiol peroxidase Tpx [102452] (4 species)
  7. 2877720Species Escherichia coli [TaxId:562] [102453] (1 PDB entry)
  8. 2877722Domain d1qxhb_: 1qxh B: [96529]

Details for d1qxhb_

PDB Entry: 1qxh (more details), 2.2 Å

PDB Description: Crystal Structure of Escherichia coli Thiol Peroxidase in the Oxidized State
PDB Compounds: (B:) Thiol Peroxidase

SCOPe Domain Sequences for d1qxhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qxhb_ c.47.1.10 (B:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]}
sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvc
aasvrkfnqlateidntvvlcisadlpfaqsrfcgaeglnnvitlstfrnaeflqaygva
iadgplkglaaravvvidendnvifsqlvdeittepdyeaalav

SCOPe Domain Coordinates for d1qxhb_:

Click to download the PDB-style file with coordinates for d1qxhb_.
(The format of our PDB-style files is described here.)

Timeline for d1qxhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qxha_