Lineage for d1qwrb_ (1qwr B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814698Family b.82.1.3: Type I phosphomannose isomerase [51191] (4 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2814699Protein Mannose-6-phosphate isomerase ManA [101987] (1 species)
  7. 2814700Species Bacillus subtilis [TaxId:1423] [101988] (1 PDB entry)
  8. 2814702Domain d1qwrb_: 1qwr B: [96492]
    complexed with act, fmt, so4, zn

Details for d1qwrb_

PDB Entry: 1qwr (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of the Mannose 6-Phosphate Isomerase from Bacillus subtilis
PDB Compounds: (B:) Mannose-6-phosphate isomerase

SCOPe Domain Sequences for d1qwrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwrb_ b.82.1.3 (B:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]}
qspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktli
elweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyiid
ckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalckgalvl
etqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgitiktf
vqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilpaqmpd
ftikgtctlivshi

SCOPe Domain Coordinates for d1qwrb_:

Click to download the PDB-style file with coordinates for d1qwrb_.
(The format of our PDB-style files is described here.)

Timeline for d1qwrb_: