PDB entry 1qwr

View 1qwr on RCSB PDB site
Description: Crystal Structure Analysis of the Mannose 6-Phosphate Isomerase from Bacillus subtilis
Class: isomerase
Keywords: Structural genomics, D-Mannose 6-phosphate, Isomerase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2003-09-03, released 2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannose-6-phosphate isomerase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PMI OR BSU35790
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39841 (Start-318)
      • modified residue (146)
      • modified residue (263)
      • modified residue (302)
    Domains in SCOPe 2.08: d1qwra_
  • Chain 'B':
    Compound: Mannose-6-phosphate isomerase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PMI OR BSU35790
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39841 (Start-318)
      • modified residue (146)
      • modified residue (263)
      • modified residue (302)
    Domains in SCOPe 2.08: d1qwrb_
  • Heterogens: SO4, ZN, ACT, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qwrA (A:)
    snamtqspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpyk
    gktlielweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktec
    wyiidckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalck
    galvletqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgi
    tiktfvqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilp
    aqmpdftikgtctlivshi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwrA (A:)
    tqspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktl
    ielweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyii
    dckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalckgalv
    letqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgitikt
    fvqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilpaqmp
    dftikgtctlivshi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qwrB (B:)
    snamtqspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpyk
    gktlielweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktec
    wyiidckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalck
    galvletqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgi
    tiktfvqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilp
    aqmpdftikgtctlivshi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwrB (B:)
    qspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktli
    elweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyiid
    ckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfyyvpsgtlhalckgalvl
    etqqnsdatyrvydydrldsngsprelhfakavnaatvphvdgyidestesrkgitiktf
    vqgeyfsvykwdingeaemaqdesflicsviegsgllkyedktcplkkgdhfilpaqmpd
    ftikgtctlivshi