Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (2 proteins) |
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries) |
Domain d1qvyc_: 1qvy C: [96451] |
PDB Entry: 1qvy (more details), 1.6 Å
SCOP Domain Sequences for d1qvyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvyc_ b.1.18.8 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus)} vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk tdhlswewnltirrdwkd
Timeline for d1qvyc_: