Lineage for d1qvyc_ (1qvy C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362347Family b.1.18.8: RhoGDI-like [81288] (3 protein domains)
  6. 2362379Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 2362384Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 2362389Domain d1qvyc_: 1qvy C: [96451]
    complexed with so4; mutant

Details for d1qvyc_

PDB Entry: 1qvy (more details), 1.6 Å

PDB Description: Crystal structure of RhoGDI K(199,200)R double mutant
PDB Compounds: (C:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1qvyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvyc_ b.1.18.8 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltirrdwkd

SCOPe Domain Coordinates for d1qvyc_:

Click to download the PDB-style file with coordinates for d1qvyc_.
(The format of our PDB-style files is described here.)

Timeline for d1qvyc_: