PDB entry 1qvy

View 1qvy on RCSB PDB site
Description: crystal structure of rhogdi k(199,200)r double mutant
Deposited on 2003-08-29, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qvya_
  • Chain 'B':
    Domains in SCOP 1.67: d1qvyb_
  • Chain 'C':
    Domains in SCOP 1.67: d1qvyc_
  • Chain 'D':
    Domains in SCOP 1.67: d1qvyd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qvyA (A:)
    mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
    mkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
    ktdhlswewnltirrdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvyA (A:)
    vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
    kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
    tdhlswewnltirrdwkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qvyB (B:)
    mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
    mkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
    ktdhlswewnltirrdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvyB (B:)
    vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
    kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
    tdhlswewnltirrdwkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qvyC (C:)
    mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
    mkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
    ktdhlswewnltirrdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvyC (C:)
    vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
    kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
    tdhlswewnltirrdwkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qvyD (D:)
    mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
    mkyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
    ktdhlswewnltirrdwkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvyD (D:)
    vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
    kyiqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
    tdhlswewnltirrdwkd