Lineage for d1qvft_ (1qvf T:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035872Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
    automatically mapped to Pfam PF01246
  6. 3035873Protein Ribosomal protein L24e [57750] (1 species)
  7. 3035874Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 3035913Domain d1qvft_: 1qvf T: [96382]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvft_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (T:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d1qvft_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvft_ g.39.1.6 (T:) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1qvft_:

Click to download the PDB-style file with coordinates for d1qvft_.
(The format of our PDB-style files is described here.)

Timeline for d1qvft_: