Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) automatically mapped to Pfam PF00347 |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) Uniprot P14135 |
Domain d1qvfe1: 1qvf E:1-79 [96366] Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1qvf (more details), 3.1 Å
SCOPe Domain Sequences for d1qvfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvfe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]} prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms tigtfqshienmfhgvteg
Timeline for d1qvfe1:
View in 3D Domains from other chains: (mouse over for more information) d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ |