SCOPe 2.08: Domain d1q9oc1: 1q9o C:1-107

Lineage for d1q9oc1 (1q9o C:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)

8. Domain d1q9oc1: 1q9o C:1-107 [96296]
   Other proteins in same PDB: d1q9oa2, d1q9ob1, d1q9ob2, d1q9oc2, d1q9od1, d1q9od2
   part of Fab s45-18
   complexed with mg

Details for d1q9oc1

PDB Entry: 1q9o, 1.79 Å

PDB Description: S45-18 Fab Unliganded

PDB Compounds: (C:) S45-2 Fab (IgG1k) light chain

SCOPe Domain Sequences for d1q9oc1:

Sequence; same for both SEQRES and ATOM records:

>d1q9oc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqfpsslavsagekvtmsckssqsllnsrtrksylawyqqkpgqfpklliywaatr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d1q9oc1:

• d1q9oc1 first appeared in SCOP 1.67
  
• d1q9oc1 appears in SCOPe 2.07