PDB entry 1q9o

View 1q9o on RCSB PDB site
Description: S45-18 Fab Unliganded
Class: immune system
Keywords: antigen-binding fragment, Fab, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, IMMUNE SYSTEM
Deposited on 2003-08-25, released 2004-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.22
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S45-2 Fab (IgG1k) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9O (0-218)
    Domains in SCOPe 2.07: d1q9oa1, d1q9oa2
  • Chain 'B':
    Compound: S45-2 Fab (IgG1k) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9O (0-225)
    Domains in SCOPe 2.07: d1q9ob1, d1q9ob2
  • Chain 'C':
    Compound: S45-2 Fab (IgG1k) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9O (0-218)
    Domains in SCOPe 2.07: d1q9oc1, d1q9oc2
  • Chain 'D':
    Compound: S45-2 Fab (IgG1k) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q9O (0-225)
    Domains in SCOPe 2.07: d1q9od1, d1q9od2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9oA (A:)
    divmsqfpsslavsagekvtmsckssqsllnsrtrksylawyqqkpgqfpklliywaatr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9oB (B:)
    evilvesggglvqpggslrlscstsgftftdyymswvrqppgkalewlgfirnkpkgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycvrdiysfgsrdgmdywgqgtsv
    tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
    lqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9oC (C:)
    divmsqfpsslavsagekvtmsckssqsllnsrtrksylawyqqkpgqfpklliywaatr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q9oD (D:)
    evilvesggglvqpggslrlscstsgftftdyymswvrqppgkalewlgfirnkpkgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyycvrdiysfgsrdgmdywgqgtsv
    tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
    lqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc