SCOPe 2.07: Domain d1q9cg_: 1q9c G:

Lineage for d1q9cg_ (1q9c G:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein Histone domain of Son of sevenless protein [101107] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101108] (1 PDB entry)

8. Domain d1q9cg_: 1q9c G: [96264]

Details for d1q9cg_

PDB Entry: 1q9c, 3.21 Å

PDB Description: Crystal Structure of the Histone domain of Son of Sevenless

PDB Compounds: (G:) Son of sevenless protein

SCOPe Domain Sequences for d1q9cg_:

Sequence; same for both SEQRES and ATOM records:

>d1q9cg_ a.22.1.3 (G:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqd

Timeline for d1q9cg_:

• d1q9cg_ first appeared in SCOP 1.67
  
• d1q9cg_ appears in SCOPe 2.06
  
• d1q9cg_ appears in the current release, SCOPe 2.08