![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
![]() | Protein Histone domain of Son of sevenless protein [101107] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101108] (1 PDB entry) |
![]() | Domain d1q9cg_: 1q9c G: [96264] multiple common domains: applies to families that are inconsistently divided into domains |
PDB Entry: 1q9c (more details), 3.21 Å
SCOPe Domain Sequences for d1q9cg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9cg_ a.22.1.3 (G:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqd
Timeline for d1q9cg_: