Lineage for d1q8rb_ (1q8r B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2202312Superfamily d.79.6: Holliday junction resolvase RusA [103084] (1 family) (S)
    automatically mapped to Pfam PF05866
  5. 2202313Family d.79.6.1: Holliday junction resolvase RusA [103085] (2 proteins)
  6. 2202314Protein Holliday junction resolvase RusA [103086] (1 species)
  7. 2202315Species Escherichia coli [TaxId:562] [103087] (1 PDB entry)
  8. 2202317Domain d1q8rb_: 1q8r B: [96226]

Details for d1q8rb_

PDB Entry: 1q8r (more details), 1.9 Å

PDB Description: Structure of E.coli RusA Holliday junction resolvase
PDB Compounds: (B:) Crossover junction endodeoxyribonuclease rusA

SCOPe Domain Sequences for d1q8rb_:

Sequence, based on SEQRES records: (download)

>d1q8rb_ d.79.6.1 (B:) Holliday junction resolvase RusA {Escherichia coli [TaxId: 562]}
mntysitlpwppsnnryyrhnrgrthvsaegqayrdnvariiknamldiglampvkirie
chmpdrrrrdldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemg

Sequence, based on observed residues (ATOM records): (download)

>d1q8rb_ d.79.6.1 (B:) Holliday junction resolvase RusA {Escherichia coli [TaxId: 562]}
mntysitlpwppsnnryvsaegqayrdnvariiknamldiglampvkiriechmpdrrrr
dldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemg

SCOPe Domain Coordinates for d1q8rb_:

Click to download the PDB-style file with coordinates for d1q8rb_.
(The format of our PDB-style files is described here.)

Timeline for d1q8rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q8ra_