PDB entry 1q8r

View 1q8r on RCSB PDB site
Description: Structure of E.coli RusA Holliday junction resolvase
Class: recombination,hydrolase
Keywords: extended mixed beta sheet, chorismate mutase-like fold, RECOMBINATION,HYDROLASE
Deposited on 2003-08-22, released 2004-01-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Crossover junction endodeoxyribonuclease rusA
    Species: Escherichia coli [TaxId:562]
    Gene: rusa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q8ra_
  • Chain 'B':
    Compound: Crossover junction endodeoxyribonuclease rusA
    Species: Escherichia coli [TaxId:562]
    Gene: rusa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q8rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q8rA (A:)
    mntysitlpwppsnnryyrhnrgrthvsaegqayrdnvariiknamldiglampvkirie
    chmpdrrrrdldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8rA (A:)
    mntysitlpwppsnnryyrhnrgrthvsaegqayrdnvariiknamldiglampvkirie
    chmpdrrrrdldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q8rB (B:)
    mntysitlpwppsnnryyrhnrgrthvsaegqayrdnvariiknamldiglampvkirie
    chmpdrrrrdldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q8rB (B:)
    mntysitlpwppsnnryvsaegqayrdnvariiknamldiglampvkiriechmpdrrrr
    dldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemg