Lineage for d1q86l_ (1q86 L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787772Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2787773Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2787774Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2787775Protein Ribosomal protein L14 [50195] (5 species)
  7. 2787815Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 2787855Domain d1q86l_: 1q86 L: [96177]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, pha

Details for d1q86l_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (L:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1q86l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q86l_ b.39.1.1 (L:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d1q86l_:

Click to download the PDB-style file with coordinates for d1q86l_.
(The format of our PDB-style files is described here.)

Timeline for d1q86l_: