![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.77: RL5-like [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
![]() | Superfamily d.77.1: RL5-like [55282] (3 families) ![]() |
![]() | Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
![]() | Protein Ribosomal protein L5 [55284] (5 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
![]() | Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries) Uniprot P14124 |
![]() | Domain d1q86f_: 1q86 F: [96170] Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ protein/RNA complex; complexed with cd, cl, k, mg, na, pha |
PDB Entry: 1q86 (more details), 3 Å
SCOPe Domain Sequences for d1q86f_:
Sequence, based on SEQRES records: (download)
>d1q86f_ d.77.1.1 (F:) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]} fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev
>d1q86f_ d.77.1.1 (F:) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]} fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk hrlnpadavafiestydvev
Timeline for d1q86f_:
![]() Domains from other chains: (mouse over for more information) d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ |