![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
![]() | Protein C-terminal domain of ribosomal protein L2 [50115] (5 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries) Uniprot P20276 |
![]() | Domain d1q86c1: 1q86 C:91-237 [96166] Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ protein/RNA complex; complexed with cd, cl, k, mg, na, pha |
PDB Entry: 1q86 (more details), 3 Å
SCOPe Domain Sequences for d1q86c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q86c1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]} gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg kpksisrnappgrkvgdiaskrtgrgg
Timeline for d1q86c1:
![]() Domains from other chains: (mouse over for more information) d1q861_, d1q862_, d1q863_, d1q864_, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ |