Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) |
Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
Protein Ribosomal protein L13 [52163] (2 species) synonym: 50S ribosomal protein L13p, HMAL13 |
Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries) |
Domain d1q81k_: 1q81 K: [96108] Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q81 (more details), 2.95 Å
SCOP Domain Sequences for d1q81k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q81k_ c.21.1.1 (K:) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]} aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr lsnikfvtlgeisetlganktw
Timeline for d1q81k_:
View in 3D Domains from other chains: (mouse over for more information) d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ |