SCOP 1.73: Domain d1q81c2: 1q81 C:1-90

Lineage for d1q81c2 (1q81 C:1-90)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
   incomplete OB-fold lacking the last strand

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
   includes the N-terminal tail

8. Domain d1q81c2: 1q81 C:1-90 [96099]
   Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
   complexed with cd, cl, k, mg, na, ppu

Details for d1q81c2

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

PDB Compounds: (C:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1q81c2:

Sequence; same for both SEQRES and ATOM records:

>d1q81c2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

Timeline for d1q81c2:

• d1q81c2 first appeared in SCOP 1.67
  
• d1q81c2 appears in SCOP 1.71
  
• d1q81c2 appears in SCOP 1.75
  
• d1q81c2 appears in the current release, SCOPe 2.08