SCOPe 2.05: Domain d1q7yw_: 1q7y W:

Lineage for d1q7yw_ (1q7y W:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)
   automatically mapped to Pfam PF00831

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
   Uniprot P10971

8. Domain d1q7yw_: 1q7y W: [96086]
   Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yx_, d1q7yy_, d1q7yz_
   protein/RNA complex; complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yw_

PDB Entry: 1q7y, 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

PDB Compounds: (W:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1q7yw_:

Sequence; same for both SEQRES and ATOM records:

>d1q7yw_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1q7yw_:

• d1q7yw_ first appeared in SCOP 1.67
  
• d1q7yw_ appears in SCOPe 2.04
  
• d1q7yw_ appears in SCOPe 2.06
  
• d1q7yw_ appears in the current release, SCOPe 2.08