Lineage for d1q5qe_ (1q5q E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2226356Species Rhodococcus erythropolis [TaxId:1833] [103314] (3 PDB entries)
  8. 2226361Domain d1q5qe_: 1q5q E: [95908]
    Other proteins in same PDB: d1q5qh_, d1q5qi_, d1q5qj_, d1q5qk_, d1q5ql_, d1q5qm_, d1q5qn_

Details for d1q5qe_

PDB Entry: 1q5q (more details), 2.6 Å

PDB Description: The Rhodococcus 20S proteasome
PDB Compounds: (E:) proteasome alpha-type subunit 1

SCOPe Domain Sequences for d1q5qe_:

Sequence, based on SEQRES records: (download)

>d1q5qe_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpae

Sequence, based on observed residues (ATOM records): (download)

>d1q5qe_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
rqggvdvaslevavldqsrprrafrriagtaleqlvpae

SCOPe Domain Coordinates for d1q5qe_:

Click to download the PDB-style file with coordinates for d1q5qe_.
(The format of our PDB-style files is described here.)

Timeline for d1q5qe_: