Lineage for d1q57c2 (1q57 C:64-263)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884995Fold e.13: DNA primase core [56730] (1 superfamily)
    2 domains: (1) alpha+beta; (2) toprim alpha/beta
  4. 884996Superfamily e.13.1: DNA primase core [56731] (2 families) (S)
  5. 885007Family e.13.1.2: Primase fragment of primase-helicase protein [90090] (1 protein)
  6. 885008Protein Primase fragment of primase-helicase protein [90091] (1 species)
  7. 885009Species Bacteriophage T7 [TaxId:10760] [90092] (2 PDB entries)
  8. 885014Domain d1q57c2: 1q57 C:64-263 [95872]
    Other proteins in same PDB: d1q57a1, d1q57b1, d1q57c1, d1q57d1, d1q57e1, d1q57f1, d1q57g1

Details for d1q57c2

PDB Entry: 1q57 (more details), 3.45 Å

PDB Description: the crystal structure of the bifunctional primase-helicase of bacteriophage t7
PDB Compounds: (C:) DNA primase/helicase

SCOP Domain Sequences for d1q57c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q57c2 e.13.1.2 (C:64-263) Primase fragment of primase-helicase protein {Bacteriophage T7 [TaxId: 10760]}
mtynvwnfgesngrysaltargisketcqkagywiakvdgvmyqvadyrdqngnivsqkv
rdkdknfkttgshksdalfgkhlwnggkkivvtegeidmltvmelqdckypvvslghgas
aakktcaanyeyfdqfeqiilmfdmdeagrkaveeaaqvlpagkvrvavlpckdanechl
nghdreimeqvwnagpwipd

SCOP Domain Coordinates for d1q57c2:

Click to download the PDB-style file with coordinates for d1q57c2.
(The format of our PDB-style files is described here.)

Timeline for d1q57c2: