Lineage for d1q57c1 (1q57 C:264-549)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831197Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (17 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 831426Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)
  7. 831427Species Bacteriophage T7 [TaxId:10760] [52675] (7 PDB entries)
  8. 831446Domain d1q57c1: 1q57 C:264-549 [95871]
    Other proteins in same PDB: d1q57a2, d1q57b2, d1q57c2, d1q57d2, d1q57e2, d1q57f2, d1q57g2

Details for d1q57c1

PDB Entry: 1q57 (more details), 3.45 Å

PDB Description: the crystal structure of the bifunctional primase-helicase of bacteriophage t7
PDB Compounds: (C:) DNA primase/helicase

SCOP Domain Sequences for d1q57c1:

Sequence, based on SEQRES records: (download)

>d1q57c1 c.37.1.11 (C:264-549) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}
gvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmvmstfvr
qqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfd
elfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkmid
nlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiiale
rnqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

Sequence, based on observed residues (ATOM records): (download)

>d1q57c1 c.37.1.11 (C:264-549) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}
gvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmvmstfvr
qqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfd
elfgndtfhlydsfetdrllaklaymrsglgcdviildhisivvsasgesderkmidnlm
tklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiialernq
qgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

SCOP Domain Coordinates for d1q57c1:

Click to download the PDB-style file with coordinates for d1q57c1.
(The format of our PDB-style files is described here.)

Timeline for d1q57c1: