![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins) automatically mapped to Pfam PF07876 |
![]() | Protein Hypothetical protein AT3G17210.1 [89928] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (4 PDB entries) |
![]() | Domain d1q4ra_: 1q4r A: [95823] structural genomics complexed with mg |
PDB Entry: 1q4r (more details), 1.9 Å
SCOPe Domain Sequences for d1q4ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4ra_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifes tfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
Timeline for d1q4ra_: