PDB entry 1q4r

View 1q4r on RCSB PDB site
Description: Gene Product of At3g17210 from Arabidopsis Thaliana
Class: unknown function, structural genomics
Keywords: Arabidopsis Thaliana, Center for Eukaryotic Structural Genomics, Structural Genomics, Protein Structure Initiative, CESG, UNKNOWN FUNCTION
Deposited on 2003-08-04, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein At3g17210
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g17210
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LUV2 (Start-111)
      • modified residue (44)
    Domains in SCOPe 2.08: d1q4ra_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q4rA (A:)
    gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
    qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q4rA (A:)
    pvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifes
    tfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl