Lineage for d1q4qj_ (1q4q J:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038090Protein BIR domains of DIAP1 [69974] (1 species)
  7. 3038091Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69975] (6 PDB entries)
  8. 3038104Domain d1q4qj_: 1q4q J: [95822]
    BIR2 complexed with dronc peptide
    complexed with zn

Details for d1q4qj_

PDB Entry: 1q4q (more details), 2.1 Å

PDB Description: crystal structure of a diap1-dronc complex
PDB Compounds: (J:) apoptosis 1 inhibitor

SCOPe Domain Sequences for d1q4qj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4qj_ g.52.1.1 (J:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdrvrcfscggglmdwnd
ndepweqhalwlsqcrfvklmkgqlyidtvaakpvlaeeke

SCOPe Domain Coordinates for d1q4qj_:

Click to download the PDB-style file with coordinates for d1q4qj_.
(The format of our PDB-style files is described here.)

Timeline for d1q4qj_: