Class g: Small proteins [56992] (100 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein BIR domains of DIAP1 [69974] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69975] (6 PDB entries) |
Domain d1q4qe_: 1q4q E: [95817] BIR2 complexed with dronc peptide complexed with zn |
PDB Entry: 1q4q (more details), 2.1 Å
SCOPe Domain Sequences for d1q4qe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4qe_ g.52.1.1 (E:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} yfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdrvrcfscggglmdwnd ndepweqhalwlsqcrfvklmkgqlyidtvaakpvlaeeke
Timeline for d1q4qe_: