SCOPe 2.02: Domain d1q4ja1: 1q4j A:86-211

Lineage for d1q4ja1 (1q4j A:86-211)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Pf GST [101210] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [101211] (4 PDB entries)

8. Domain d1q4ja1: 1q4j A:86-211 [95793]
   Other proteins in same PDB: d1q4ja2, d1q4jb2
   complexed with gtx

Details for d1q4ja1

PDB Entry: 1q4j, 2.2 Å

PDB Description: Crystal Structure of Pf-GST1 with its inhibitor s-hexyl-GSH

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1q4ja1:

Sequence; same for both SEQRES and ATOM records:

>d1q4ja1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy

Timeline for d1q4ja1:

• d1q4ja1 first appeared in SCOP 1.67
  
• d1q4ja1 appears in SCOPe 2.01
  
• d1q4ja1 appears in SCOPe 2.03
  
• d1q4ja1 appears in the current release, SCOPe 2.08