| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Pf GST [101210] (1 species) cannot be assigned to any of the known GST classes |
| Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [101211] (6 PDB entries) |
| Domain d1q4ja1: 1q4j A:86-211 [95793] Other proteins in same PDB: d1q4ja2, d1q4jb2 complexed with gtx |
PDB Entry: 1q4j (more details), 2.2 Å
SCOPe Domain Sequences for d1q4ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4ja1 a.45.1.1 (A:86-211) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy
Timeline for d1q4ja1: