SCOPe 2.04: Domain d1q48a_: 1q48 A:

Lineage for d1q48a_ (1q48 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)

6. Protein NifU-like protein HI0377 [102929] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [102930] (2 PDB entries)
   Uniprot Q57074

8. Domain d1q48a_: 1q48 A: [95783]
   structural genomics; NESG target IR24

Details for d1q48a_

PDB Entry: 1q48

PDB Description: Solution NMR Structure of The Haemophilus Influenzae Iron-Sulfur Cluster Assembly Protein U (IscU) with Zinc Bound at the Active Site. Northeast Structural Genomics Consortium Target IR24. This protein is not apo, it is a model without zinc binding constraints.

PDB Compounds: (A:) NifU-like protein

SCOPe Domain Sequences for d1q48a_:

Sequence; same for both SEQRES and ATOM records:

>d1q48a_ d.224.1.2 (A:) NifU-like protein HI0377 {Haemophilus influenzae [TaxId: 727]}
maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfkt
ygcgsaiassslitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiad
ykakqglehhhhhh

Timeline for d1q48a_:

• d1q48a_ first appeared in SCOP 1.67
  
• d1q48a_ appears in SCOPe 2.03
  
• d1q48a_ appears in SCOPe 2.05
  
• d1q48a_ appears in the current release, SCOPe 2.08, called d1q48a1