Lineage for d1q48a_ (1q48 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446741Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1446742Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1446757Family d.224.1.2: NifU/IscU domain [102928] (4 proteins)
  6. 1446767Protein NifU-like protein HI0377 [102929] (1 species)
  7. 1446768Species Haemophilus influenzae [TaxId:727] [102930] (2 PDB entries)
    Uniprot Q57074
  8. 1446770Domain d1q48a_: 1q48 A: [95783]
    structural genomics; NESG target IR24

Details for d1q48a_

PDB Entry: 1q48 (more details)

PDB Description: Solution NMR Structure of The Haemophilus Influenzae Iron-Sulfur Cluster Assembly Protein U (IscU) with Zinc Bound at the Active Site. Northeast Structural Genomics Consortium Target IR24. This protein is not apo, it is a model without zinc binding constraints.
PDB Compounds: (A:) NifU-like protein

SCOPe Domain Sequences for d1q48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q48a_ d.224.1.2 (A:) NifU-like protein HI0377 {Haemophilus influenzae [TaxId: 727]}
maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfkt
ygcgsaiassslitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiad
ykakqglehhhhhh

SCOPe Domain Coordinates for d1q48a_:

Click to download the PDB-style file with coordinates for d1q48a_.
(The format of our PDB-style files is described here.)

Timeline for d1q48a_: