Lineage for d1q43a_ (1q43 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816664Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2816755Protein HCN pacemaker channel [101993] (1 species)
    potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel
  7. 2816756Species Mouse (Mus musculus) [TaxId:10090] [101994] (10 PDB entries)
  8. 2816759Domain d1q43a_: 1q43 A: [95777]
    complexed with cmp

Details for d1q43a_

PDB Entry: 1q43 (more details), 2 Å

PDB Description: HCN2I 443-640 in the presence of cAMP, selenomethionine derivative
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d1q43a_:

Sequence, based on SEQRES records: (download)

>d1q43a_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldr

Sequence, based on observed residues (ATOM records): (download)

>d1q43a_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrrafe
tvaidrldr

SCOPe Domain Coordinates for d1q43a_:

Click to download the PDB-style file with coordinates for d1q43a_.
(The format of our PDB-style files is described here.)

Timeline for d1q43a_: