SCOP 1.67: Domain d1q43a_: 1q43 A:

Lineage for d1q43a_ (1q43 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (5 proteins)

6. Protein HCN pacemaker channel [101993] (1 species)
   potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel

7. Species Mouse (Mus musculus) [TaxId:10090] [101994] (3 PDB entries)

8. Domain d1q43a_: 1q43 A: [95777]

Details for d1q43a_

PDB Entry: 1q43, 2 Å

PDB Description: HCN2I 443-640 in the presence of cAMP, selenomethionine derivative

SCOP Domain Sequences for d1q43a_:

Sequence, based on SEQRES records:

>d1q43a_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus)}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldr

Sequence, based on observed residues (ATOM records):

>d1q43a_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus)}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrrafe
tvaidrldr

Timeline for d1q43a_:

• d1q43a_ is new in SCOP 1.67
  
• d1q43a_ appears in SCOP 1.69
  
• d1q43a_ appears in the current release, SCOPe 2.08